Protein Info for PFLU_RS02495 in Pseudomonas fluorescens SBW25-INTG

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00163: phosphatidylserine decarboxylase
  • amino acids 53 to 283 (231 residues), 257.5 bits, E=4.7e-81
• PF02666: PS_Dcarbxylase
  • amino acids 63 to 282 (220 residues), 213.6 bits, E=1.2e-67

Best Hits

Swiss-Prot: 100% identical to PSD_PSEFS: Phosphatidylserine decarboxylase proenzyme (psd) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to pfs:PFLU0505)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

See C3KDM6 at UniProt or InterPro

Protein Sequence (286 amino acids)

>PFLU_RS02495 phosphatidylserine decarboxylase (Pseudomonas fluorescens SBW25-INTG)
MKKQLFILSQYLLPHHLLSRLAGCIAECRVRWFKNAFTAWFAKRYQVDMSQALVEDLTAY
EHFNAFFTRALKDGARPLDQTPGAVLSPADGAVSQLGPIEHGRVFQAKGHSFSVLELLGG
DAALSAPFMGGDFATVYLSPKDYHRVHMPLAGTLREMVYIPGRIFSVNQTTAENVPELFA
RNERVACIFDTERGPMAVVLVGAMIVASIETVWAGLVTPPKRELKTFRYDEAARAPIHLE
KGAELGRFKLGSTAIVLFGPDQVKWAEELVAGSPVQMGQGIAAPKA