Protein Info for PFLU_RS02250 in Pseudomonas fluorescens SBW25-INTG

Annotation: O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01326: O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
  • amino acids 4 to 420 (417 residues), 644.7 bits, E=2.7e-198
• PF01053: Cys_Met_Meta_PP
  • amino acids 5 to 420 (416 residues), 445.4 bits, E=2.5e-137
• PF01041: DegT_DnrJ_EryC1
  • amino acids 56 to 183 (128 residues), 27.8 bits, E=3e-10
• PF00155: Aminotran_1_2
  • amino acids 60 to 180 (121 residues), 26 bits, E=1e-09
• PF00266: Aminotran_5
  • amino acids 79 to 210 (132 residues), 34.2 bits, E=2.9e-12

Best Hits

Swiss-Prot: 52% identical to METY1_THET8: O-acetyl-L-homoserine sulfhydrylase 1 (oah1) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K01740, O-acetylhomoserine (thiol)-lyase [EC: 2.5.1.49] (inferred from 100% identity to pfs:PFLU0455)

MetaCyc: 48% identical to O-acetylhomoserine aminocarboxypropyltransferase (Rhodospirillum rubrum)
O-acetylhomoserine aminocarboxypropyltransferase. [EC: 2.5.1.49]

Predicted SEED Role

"O-acetylhomoserine sulfhydrylase (EC 2.5.1.49) / O-succinylhomoserine sulfhydrylase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48, EC 2.5.1.49)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• L-methionine biosynthesis III (4/4 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-homocysteine biosynthesis (2/2 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• L-methionine biosynthesis I (3/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48, 2.5.1.49

Use Curated BLAST to search for 2.5.1.48 or 2.5.1.49

Sequence Analysis Tools

See C3KCN9 at UniProt or InterPro

Protein Sequence (425 amino acids)

>PFLU_RS02250 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (Pseudomonas fluorescens SBW25-INTG)
MKDATIALHHGFKSDPTTKAVAVPIYQNVAFEFDNAQHGADLFNLDVPGNIYTRIMNPTN
DVLEQRIAALEGGIAGLAVSAGSAAIHYAIQTLTRAGDNIVTTPQLYGGTYTLFAHLLPS
FGVDVRFARDDSAAAIAELIDDNTKLVYCESIGNPAGNIIDIEALANVAHARGVPLVVDN
TVATPILCKPIQFGADIVVHSVTKYIGGHGNSLGGVIVDSGTFPWTDYPDKFPGLNTPEP
AYHGVVYTEKFGPAAFIARARTVPLRNTGAALAPMNAFLLLQGLETLALRMERHTENALK
VAQFLQGHADVEWVSYAGLPDHPHHALAQKYLQGKPSAILSFGLKGGYDAGVRFYDALQI
FKRLVNIGDAKSLACHPASTTHRQMNEQEQAKAGVKPEMIRLSVGIEAIEDLLEDLQQAL
GSTQL