Protein Info for PFLU_RS02015 in Pseudomonas fluorescens SBW25-INTG

Annotation: type 4a pilus biogenesis protein PilO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details PF04350: PilO" amino acids 50 to 186 (137 residues), 108.6 bits, see alignment E=3.2e-35 PF04351: PilP" amino acids 196 to 317 (122 residues), 101.1 bits, see alignment E=5.6e-33

Best Hits

KEGG orthology group: K02664, type IV pilus assembly protein PilO (inferred from 100% identity to pfs:PFLU0409)

Predicted SEED Role

"Type IV pilus biogenesis protein PilO / Type IV pilus biogenesis protein PilP" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAI1 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PFLU_RS02015 type 4a pilus biogenesis protein PilO (Pseudomonas fluorescens SBW25-INTG)
MSLPRLTLSALTHNAAKWPLPGKALLGCALAGVVFVVGDLVYLSPSRERLRQVEAREVAL
QQHVTQKTVLAASLEARTQQLQLMQSTADELFQALPGASEMPGLLEDIAGLALANGLLVE
SVTPLDEQPRSFYHEQPVQIGLTGAYHDQAMFLSSLGSLPRIATVHDVTLRREGTLVRLD
LLAKAYWRQGGGVAGQVQRRQPFAYDISGLRDPFRRLAVQVDHVPGRPARAPDLGRPRGA
LESLAVEQFQMVGTLSRGLQAFALLRAASKVHRLAVGDYLGPDHGRVTAIHERYIELVEL
FPDGQGAWLERPRTLVLNVNS