Protein Info for PFLU_RS01965 in Pseudomonas fluorescens SBW25-INTG

Annotation: ATP-dependent protease subunit HslV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 2 to 169 (168 residues), 80.3 bits, E=7.4e-27
• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 2 to 171 (170 residues), 279.4 bits, E=4.8e-88

Best Hits

Swiss-Prot: 100% identical to HSLV_PSEFS: ATP-dependent protease subunit HslV (hslV) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 100% identity to pfs:PFLU0399)

MetaCyc: 76% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

See C3KAH1 at UniProt or InterPro

Protein Sequence (176 amino acids)

>PFLU_RS01965 ATP-dependent protease subunit HslV (Pseudomonas fluorescens SBW25-INTG)
MTTIVSVRRHGKVVMGGDGQVSLGNTVMKGNAKKVRRLYHGQVLAGFAGATADAFTLFER
FEGQLEKHQGHLVRAAVELAKEWRTDRSLSRLEAMLAVANKDASLIITGNGDVVEPEHGL
IAMGSGGGYAQAAASALLKKTDLSAREIVETALGIAGDICVFTNHNQTIEEQDLAE