Protein Info for PFLU_RS01835 in Pseudomonas fluorescens SBW25-INTG

Annotation: glucan biosynthesis protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF04349: MdoG" amino acids 38 to 510 (473 residues), 631.9 bits, see alignment E=4.3e-194

Best Hits

Swiss-Prot: 73% identical to OPGG_PSEE4: Glucans biosynthesis protein G (opgG) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K03670, periplasmic glucans biosynthesis protein (inferred from 100% identity to pfs:PFLU0373)

Predicted SEED Role

"Glucans biosynthesis protein G precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K815 at UniProt or InterPro

Protein Sequence (578 amino acids)

>PFLU_RS01835 glucan biosynthesis protein G (Pseudomonas fluorescens SBW25-INTG)
MIVSPCNAPKLSAKRLRNALVTGSALFCLFGAGQLWAFSLDDVSAKAKELAGQKYEAPRS
NLPNEFREMKFADYQKIRFRNEKAEWADQNTPFKLSFYHQGMHFDTPVKINEVTADSVQE
IKYDPTRFDFGDVKFDPKATEQLGYAGFRVLYPINKADKQDEIMTMLGASYFRVVGKGQS
YGLSARGMAIDTALPSGEEFPRFTEFWIERPKPGEKQLVIFALLDSPRATGAYRLILRPG
TDTIVDVKSQMFLRDKVTKLGVAPLTSMYLFGANQPSKVLNYRRELHDSSGLSIHAGNGE
WIWRPLNNPKHLSVSNFTVENPKGFGLLQRGRDFSHYEDLDDNYDKRPSAWIEPEGDWGK
GTVNLVEIPTADETNDNIVAFWSPEKLPEVGQPLDVSYRLHWTMDEKALHPADSAWVKQT
LRSTGDVKQSNLIRQPDGSVAYLVDFEGPSLKALPADAPVRSQVSVSDNAELVENSVRYN
EHTKGWRLTLRMKIKDAGKPTEMRAALVQDVAPPAPEQDSSHVLKADKVLAKQHEKQAKK
DAKDKEAKQPEAAPATPEPIKTEQVLTETWSYQLPADE