Protein Info for PFLU_RS01820 in Pseudomonas fluorescens SBW25-INTG

Annotation: N-formylglutamate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR02017: N-formylglutamate deformylase" amino acids 4 to 262 (259 residues), 391.3 bits, see alignment E=1.1e-121 PF05013: FGase" amino acids 13 to 230 (218 residues), 246 bits, see alignment E=2.5e-77

Best Hits

KEGG orthology group: K01479, formiminoglutamase [EC: 3.5.3.8] (inferred from 100% identity to pfs:PFLU0370)

MetaCyc: 76% identical to N-formylglutamate amidohydrolase (Pseudomonas putida)
N-formylglutamate deformylase. [EC: 3.5.1.68]

Predicted SEED Role

"N-formylglutamate deformylase (EC 3.5.1.68)" in subsystem Histidine Degradation (EC 3.5.1.68)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.68 or 3.5.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K812 at UniProt or InterPro

Protein Sequence (266 amino acids)

>PFLU_RS01820 N-formylglutamate deformylase (Pseudomonas fluorescens SBW25-INTG)
MDKVLNFTQGRVPLLISMPHAGLRLTPAVEAGLIPEAQSLPDTDWHIPTLYDFAEALGAS
TLSAEYSRFVIDLNRPSDDKPLYAGATTGLYPATLFEGVPLFREGLEPSETERASYLQKI
WGPYHRTLQEELARLKAEFGYALLFDAHSIRSVIPHLFDGKLPDFNLGTFNGAACDPGLA
SQLEAICATHPQYTHVLNGRFKGGHITRHYGDPAQDIHAVQLELCQSTYMEEVEPFRYRP
DVAEPTRVVLKQLLEGVLAWGQARYR