Protein Info for PFLU_RS01045 in Pseudomonas fluorescens SBW25-INTG

Annotation: CynX/NimT family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details PF07690: MFS_1" amino acids 25 to 344 (320 residues), 111.7 bits, see alignment E=1.8e-36

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 100% identity to pfs:PFLU0207)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCM8 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PFLU_RS01045 CynX/NimT family MFS transporter (Pseudomonas fluorescens SBW25-INTG)
MTLNKSLAGWGLLVVLGLNLRPILSSISPLLGEIRQATGLSFQSSALLTSLPVVCMGLVA
LVGVRVEARLGERRGIALGLIMILLACLARWLMGQASALLVTALLGGAGVALIQALVPAM
IKREFRHRVPVAMGVYSASLMAGGGLAALLSPLVATHFQEWQAGLGVWLLPALGALLLWA
WLPLGAARNPQVVPAFKDLRNRRAWLLALYFGLVNCGYMSLVAWLPAYYQQLGWGVLPSG
SLLAFMTIFQVLAALLMPVLAQRGIDRRPLLGIALLAQTVGYLGLIVAPQEYPHLWVALC
GFGLGACFALSLLLTLDHHRDPRQAGQLAAFVQGVGFLINAVSPWLTGWLRGLTGNFVSA
WVVLTVTAVAMLVVTRVFSPATYRTGLEVIAPGHS