Protein Info for PFLU_RS00935 in Pseudomonas fluorescens SBW25-INTG

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 transmembrane" amino acids 8 to 28 (21 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 80 to 204 (125 residues), 63 bits, see alignment E=3.1e-21 PF13188: PAS_8" amino acids 87 to 125 (39 residues), 29.4 bits, see alignment 2e-10 PF00989: PAS" amino acids 90 to 194 (105 residues), 45.2 bits, see alignment E=2.9e-15 PF08448: PAS_4" amino acids 92 to 196 (105 residues), 23.5 bits, see alignment E=1.9e-08 PF13426: PAS_9" amino acids 94 to 195 (102 residues), 58.3 bits, see alignment E=2.9e-19 PF08447: PAS_3" amino acids 105 to 190 (86 residues), 34.1 bits, see alignment E=9.4e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 204 to 367 (164 residues), 130.1 bits, see alignment E=6.7e-42 PF00990: GGDEF" amino acids 208 to 364 (157 residues), 156.5 bits, see alignment E=1.8e-49 PF00563: EAL" amino acids 386 to 620 (235 residues), 257.2 bits, see alignment E=4.5e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0185)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KBT5 at UniProt or InterPro

Protein Sequence (636 amino acids)

>PFLU_RS00935 EAL domain-containing protein (Pseudomonas fluorescens SBW25-INTG)
MLFSYRGARWAGLVYLLVSMTWISLTERLLIEFLDNPSALNHWLQVRGYVWVALSALVIY
LICARFARANQQQPLKENRERLRQAAAVFDCTREGVLVTDAQGLIVHVNRAFMEITGYSR
EDVMGRQPSLFKSGRHSSNFYQQMFQSLERCGEWSGEIWNRRKSGEIYPQWQTIRVIHDD
LGQVSHYVAVFSDISAIKDSEHELAHLAHHDPLTDLPNRLLFTDRAQQALASAQVHKRGC
ALLLLDLDHFKIINDSLGHNVGDQLLKLVGERLKALFGPGVTLARLGGDEFAVLAESCPQ
VAQAASLAQRMLEAMKQPFLFDGHQLFISASIGISLFPNDALSAEQLLRNADSALFKAKS
TGREGYALYTEELTAHAQNRVEIASELRRALEQKELRVYYQPVHDLNGSRLIGVEALVRW
QHPARGLVPPGEFIPIAERTGLIADIDAWVMDQACRQMCDWLAQGAPLSFIAINVSSRLF
ARRELYEQVAQVLHDTGLDPAFLELEVTESAVMDDPEVALEQLHRLRELGLRLAIDDFGT
GYSSLLRLKRLPVQKLKIDQGFVAGLPWDEDDAAIVRVVIALAKSMGMQVHAEGIEQEEQ
ARFLLDQQCDMGQGYWFGKPMPAQEIDWSRAPVIRP