Protein Info for MPMX20_04741 in Enterobacter sp. TBS_079

Annotation: Protein UmuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00717: Peptidase_S24
  • amino acids 17 to 130 (114 residues), 92.8 bits, E=6e-31

Best Hits

Swiss-Prot: 89% identical to SAMA_SALTY: Protein SamA (samA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03503, DNA polymerase V [EC: 3.4.21.-] (inferred from 89% identity to stm:PSLT055)

MetaCyc: 54% identical to DNA polymerase V protein UmuD (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]

Predicted SEED Role

"Error-prone repair protein UmuD"

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7, 3.4.21.-

Use Curated BLAST to search for 2.7.7.7 or 3.4.21.-

Protein Sequence (140 amino acids)

>MPMX20_04741 Protein UmuD (Enterobacter sp. TBS_079)
MILFVTPASEPALSTAPLFTERCPAGFPSPAADYTEDELDLNAYCIRRPSATYFVRAIGD
SMKDMGLHSGDLMVVDKAEKPMQGDIVIAETDGEFTVKRLQLKPRIALLPMNPAYPTLYP
EELQIFGVVMAFIHKTRGSN