Protein Info for MPMX20_04731 in Enterobacter sp. TBS_079

Annotation: Plasmid-derived single-stranded DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00621: single-stranded DNA-binding protein" amino acids 4 to 185 (182 residues), 188.4 bits, see alignment E=6.2e-60 PF00436: SSB" amino acids 6 to 105 (100 residues), 135.9 bits, see alignment E=2.6e-44

Best Hits

Swiss-Prot: 62% identical to SSB_YERPE: Single-stranded DNA-binding protein (ssb) from Yersinia pestis

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 77% identity to kpn:KPN_pKPN3p05983)

MetaCyc: 60% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>MPMX20_04731 Plasmid-derived single-stranded DNA-binding protein (Enterobacter sp. TBS_079)
MTVRGVNKVIIVGNLGQDPEIRYIPNGSAVANLSLATSESWRDKQTGEMRENTEWHRVVL
FGKLAEVAGEYLRKGSQVFIEGQLRTRNWQDDSGVTRYVTEIVVGQNGTMQMLGGRRDGG
QSQSMPPQQPAQPQNPAAPAQPAGSPEKSPKQKGGRKPRQSTAPSQQAPQPLPHDYPPMD
DDAPF