Protein Info for MPMX20_04709 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF06586: TraK" amino acids 14 to 230 (217 residues), 136.3 bits, see alignment E=6.6e-44 TIGR02756: type-F conjugative transfer system secretin TraK" amino acids 17 to 235 (219 residues), 137.7 bits, see alignment E=2.1e-44

Best Hits

KEGG orthology group: K12066, conjugal transfer pilus assembly protein TraK (inferred from 39% identity to kpn:KPN_pKPN4p07130)

Predicted SEED Role

"IncF plasmid conjugative transfer pilus assembly protein TraK" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>MPMX20_04709 hypothetical protein (Enterobacter sp. TBS_079)
MKNNLPALLFGTAMMVVVPPAAQAQSPATISFPQGGQFRLSISSTDPNMIFIPGDKVTAI
TAPGGMLADKRLTTAGGVLFTSVATRTFTFFVETALGQTFSVVATPVKGEGRVYRLMSAE
PPSRPETRKWEIAQAYEKLLISLNRAVLTGDIPDGYGEVKPLSDGIRLPGGFSVTPLKAW
AGDQLRADRYELRNANTWGVALREQDFWKPGVRAVMFDNNAQTLMGGGRMTVTVIRENGE
GEDGQR