Protein Info for MPMX20_04585 in Enterobacter sp. TBS_079

Annotation: HTH-type transcriptional repressor CsqR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF08220: HTH_DeoR" amino acids 11 to 66 (56 residues), 80 bits, see alignment E=3.4e-26 PF08279: HTH_11" amino acids 11 to 53 (43 residues), 38.3 bits, see alignment 4e-13 PF01047: MarR" amino acids 15 to 57 (43 residues), 27.1 bits, see alignment 1.2e-09 PF13412: HTH_24" amino acids 15 to 55 (41 residues), 24.6 bits, see alignment 6.1e-09 PF00455: DeoRC" amino acids 80 to 237 (158 residues), 163.1 bits, see alignment E=2.2e-51

Best Hits

Swiss-Prot: 88% identical to CSQR_ECOLI: HTH-type transcriptional repressor CsqR (csqR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_05101)

Predicted SEED Role

"DeoR-type transcriptional regulator YihW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>MPMX20_04585 HTH-type transcriptional repressor CsqR (Enterobacter sp. TBS_079)
MSLTELTGNPRHDQLLTLIADRGYMNIDELAQLLDVSTQTVRRDIRKLSEQGLITRHHGG
AGRASSVVNTAFEQREVSLTEEKRAIAEAIADYIPDGSTIFITIGTTVEHVARALLNHNH
LRIITNSLRVAHILYKNPRFEVMVPGGTLRPHNGGIIGPAATAFVSGFRADYLVTSVGAI
EHDGAMMEFDVNEASVVKTMMAHARHILLAADHTKYHASAAVEIGNVSQATALFTDELPG
SALQNHLKSSKVEVVEVNSGDEQQAG