Protein Info for MPMX20_04567 in Enterobacter sp. TBS_079

Annotation: Melibiose permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 14 to 39 (26 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details PF01306: LacY_symp" amino acids 9 to 413 (405 residues), 654 bits, see alignment E=1.8e-200 TIGR00882: oligosaccharide:H+ symporter" amino acids 11 to 406 (396 residues), 693.6 bits, see alignment E=3.8e-213 PF12832: MFS_1_like" amino acids 15 to 388 (374 residues), 85.9 bits, see alignment E=6.5e-28 PF07690: MFS_1" amino acids 19 to 317 (299 residues), 74.2 bits, see alignment E=1.9e-24 PF13347: MFS_2" amino acids 24 to 322 (299 residues), 30.1 bits, see alignment E=3.9e-11

Best Hits

Swiss-Prot: 98% identical to MELY_ENTCC: Melibiose permease (melY) from Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56)

KEGG orthology group: K02532, MFS transporter, OHS family, lactose permease (inferred from 98% identity to enc:ECL_05077)

MetaCyc: 58% identical to lactose permease (Escherichia coli K-12 substr. MG1655)
RXN-17755; RXN0-7215; RXN0-7217; TRANS-RXN-24; TRANS-RXN-94

Predicted SEED Role

"Lactose permease" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Lactose and Galactose Uptake and Utilization or Lactose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>MPMX20_04567 Melibiose permease (Enterobacter sp. TBS_079)
MNTTTCTHKDNPNFWIFGLFFFLYFFIMATCFPFLPIWLSDVIGLNKTHTGIVFSCISLS
AIAFQPVLGVISDKLGLKKHLLWIITVLLFLFAPFFLYVFAPLLKTSIWLGALSGGLYIG
FVFSAGSGAIEAYIERVSRNSLFEYGKARMFGCLGWGLCASTGGILFGIDPSYVFWMGSA
AALLLMLLLVVAKPKPNQTAQVMNALGANQPQITARTVFNLFRQRRMWMFILYVIGVACV
YDVFDQQFATFFKTFFATPQEGTRAFGFATTAGEICNAIIMFCSPWIINRIGAKNTLLIA
GLIMATRIIGSSFATTAVEVIALKMLHALEVPFLLVGAFKYITGVFDTRLSATIYLIGFQ
FAKQSAAIFLSAFAGNMYDRIGFQETYLMLGCFVLAITVVSAFTLSSKQEIAARRAAVEA
N