Protein Info for MPMX20_04565 in Enterobacter sp. TBS_079

Annotation: Rhamnulose-1-phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR02624: rhamnulose-1-phosphate aldolase" amino acids 1 to 272 (272 residues), 449.6 bits, see alignment E=1.8e-139 PF00596: Aldolase_II" amino acids 13 to 238 (226 residues), 75.7 bits, see alignment E=2.2e-25

Best Hits

Swiss-Prot: 90% identical to RHAD_SALA4: Rhamnulose-1-phosphate aldolase (rhaD) from Salmonella agona (strain SL483)

KEGG orthology group: K01629, rhamnulose-1-phosphate aldolase [EC: 4.1.2.19] (inferred from 92% identity to enc:ECL_05074)

MetaCyc: 88% identical to rhamnulose-1-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Rhamnulose-1-phosphate aldolase. [EC: 4.1.2.19]

Predicted SEED Role

"Rhamnulose-1-phosphate aldolase (EC 4.1.2.19)" in subsystem L-rhamnose utilization (EC 4.1.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>MPMX20_04565 Rhamnulose-1-phosphate aldolase (Enterobacter sp. TBS_079)
MQTITNAWFVQGMIKATSDAWLKGWDERNGGNLTLRLDDADIEPFAAEFHQKPRYIALSQ
PMPQLASTPFIVTGSGKFFRNVQLDPQANLGVVRVDSDGAGYHILWGLTDDAVPTSELPA
HFLSHCERIKATHGKDRVIMHCHATNLIALTYVLENSSDYLTRKLWEGSTECLVVFPDGV
GILPWMVPGTDEIGQATAIEMQSHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAEVLVK
VLSMGGMKQTITREELIALGKRFGVTPMQSALDLYP