Protein Info for MPMX20_04489 in Enterobacter sp. TBS_079

Annotation: Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details TIGR02380: undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase" amino acids 8 to 350 (343 residues), 558.3 bits, see alignment E=3.3e-172 PF00953: Glycos_transf_4" amino acids 75 to 233 (159 residues), 106.2 bits, see alignment E=8.9e-35

Best Hits

Swiss-Prot: 89% identical to WECA_ECOL6: Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (wecA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02851, undecaprenyl-phosphate alpha-N-acetylglucosaminyltransferase [EC: 2.7.8.-] (inferred from 94% identity to ent:Ent638_4002)

MetaCyc: 89% identical to UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (Escherichia coli K-12 substr. MG1655)
GLCNACPTRANS-RXN [EC: 2.7.8.33]

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.- or 2.7.8.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>MPMX20_04489 Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (Enterobacter sp. TBS_079)
MNLLTAVTELISIFLFTTCFLFIARKVAKRIGLVDKPNFRKRHQGLIPLVGGISVYAGIC
FTFGIADYYIPHAALYLACAGVLVLVGALDDRFDIAVKIRATVQAAIGVIMMVVGGLYLR
SLGYVFGPWELVLGPFGFFLTLFAVWAAINAFNMVDGIDGLLGGLSSVSFAAIGIILWFD
GQYSLSMWCFAMIAAILPYILLNLGALGRRYKVFMGDAGSTLIGFTVIWILLETTQGKTH
PISPVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPDRQHIHHLIMRAGFTSRQAFVLITL
AAAILAAIGVAAEYAHFIPEWVMLVLFLLAFFLYGYCIKRAWKVARFIKRLKRRMRRNSG
NNTTLTK