Protein Info for MPMX20_04486 in Enterobacter sp. TBS_079

Annotation: UDP-N-acetyl-D-mannosamine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03721: UDPG_MGDP_dh_N" amino acids 5 to 186 (182 residues), 199.4 bits, see alignment E=8.3e-63 TIGR03026: nucleotide sugar dehydrogenase" amino acids 5 to 416 (412 residues), 401.5 bits, see alignment E=1.9e-124 PF03446: NAD_binding_2" amino acids 5 to 136 (132 residues), 23.6 bits, see alignment E=9.3e-09 PF00984: UDPG_MGDP_dh" amino acids 206 to 293 (88 residues), 96.6 bits, see alignment E=1.6e-31 PF03720: UDPG_MGDP_dh_C" amino acids 324 to 419 (96 residues), 68.5 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 88% identical to WECC_ECOLI: UDP-N-acetyl-D-mannosamine dehydrogenase (wecC) from Escherichia coli (strain K12)

KEGG orthology group: K02472, UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase [EC: 1.1.1.-] (inferred from 96% identity to enc:ECL_04998)

MetaCyc: 88% identical to UDP-N-acetyl-D-mannosamine dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDPMANNACADEHYDROG-RXN [EC: 1.1.1.336]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.22 or 1.1.1.336

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>MPMX20_04486 UDP-N-acetyl-D-mannosamine dehydrogenase (Enterobacter sp. TBS_079)
MSFTTISVIGLGYIGLPTAAAFASRQKQVVGVDINARAVETINRGEIHIVEPDLDRVVKE
AVDGGFLRASTTPVEADAYLIAVPTPFKGDHEPDMAYVEAAVKSIAPVLKKGALVILEST
SPVGATEQMAQWLAQARPDLRFPQQAGEQADINIAYCPERVLPGQVMVELIKNDRVIGGM
TPVCSARASALYKIFLEGECVVTNSRTAEMCKLTENSFRDVNIAFANELSLICADQGINV
WELISLANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPAQARLIRTAREVNDSKPHWVL
SQVKATVADCLAESGKRASELKIACFGLAFKPNIDDLRESPAMEIAEMIAGWHTGETLVV
EPNIHELPAKLAGHCTLTALDEALATADVLVLLVDHKEFKATSGDAVRQQYVVDTKGVWR