Protein Info for MPMX20_04474 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 319 to 343 (25 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 70% identity to ent:Ent638_3991)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>MPMX20_04474 hypothetical protein (Enterobacter sp. TBS_079)
MNSLLYALIEALRCHRWLRLLACAFIFTSLGNGVTQVVVFGLLLAWSAPPALLTLAFLFA
TLPGFIGSLISEKLCVRYSPIPLLMLTEGLGLLALLFPLLGVHYHSIPALLAVQSTEALL
SGMSWPALTLLFKRGLREAELPAATCLENVIFAAQVLLGTGLGMVLFQKIAILALLAIDA
ISFLGSLFMLWLAGRVFLAPTLAVPTEEKAPAALRWQMLTIRQKRSLLILPALAAVGSPA
MALLPAMAQQIHPQDAASLALPLLFARSMGQLCGPLLLKRDSLTRFAARTPRILLCLGIF
LAAYGMLPLLSGWMACALGMIFVAHLASNVLFAAGTFAVLSSFQTTHMASASSKVWRWQT
LSASLFTGIAAMAAAGFGSIQALYSVSSAALILVALIMYVYRE