Protein Info for MPMX20_04465 in Enterobacter sp. TBS_079

Annotation: Tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF02899: Phage_int_SAM_1" amino acids 11 to 93 (83 residues), 79.2 bits, see alignment E=2.2e-26 TIGR02224: tyrosine recombinase XerC" amino acids 12 to 298 (287 residues), 358.3 bits, see alignment E=1.7e-111 PF00589: Phage_integrase" amino acids 115 to 284 (170 residues), 193.4 bits, see alignment E=2.7e-61

Best Hits

Swiss-Prot: 92% identical to XERC_SALTY: Tyrosine recombinase XerC (xerC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 96% identity to enc:ECL_04980)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>MPMX20_04465 Tyrosine recombinase XerC (Enterobacter sp. TBS_079)
MTDGLLATDVARFLRYLGVERQLSPITLLNYQRQLDAIMQIADEIGLKSWQQCDAATVRG
VVVRSRRKGLGPASLALRLSALRSFFDWLVSQGSLKANPAKGIATPKAPRHLPKNIDVDD
VNRLLDIDLNDPLAVRDRAMLEVMYGAGLRLSELVNLDIKHLDLDTGEVWVMGKGSKERR
LPIGRNAVAWIEHWLDLRGLFGAEEDALFLSKLGKRISARNVQKRFAEWGIKQGLNSHVH
PHKLRHSFATHMLESSGDLRGVQELLGHANLSTTQIYTHLDFQHLASVYDAAHPRAKRGK