Protein Info for MPMX20_04439 in Enterobacter sp. TBS_079

Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR00148: decarboxylase, UbiD family" amino acids 10 to 459 (450 residues), 623.4 bits, see alignment E=9.5e-192 PF20695: UbiD_N" amino acids 14 to 93 (80 residues), 102.4 bits, see alignment E=1.7e-33 PF01977: UbiD" amino acids 128 to 326 (199 residues), 279.9 bits, see alignment E=1.4e-87 PF20696: UbiD_C" amino acids 332 to 456 (125 residues), 160.3 bits, see alignment E=3.4e-51

Best Hits

Swiss-Prot: 96% identical to UBID_ENT38: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Enterobacter sp. (strain 638)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 98% identity to enc:ECL_04954)

MetaCyc: 94% identical to 3-octaprenyl-4-hydroxybenzoate decarboxylase (Escherichia coli K-12 substr. MG1655)
3-OCTAPRENYL-4-OHBENZOATE-DECARBOX-RXN [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>MPMX20_04439 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Enterobacter sp. TBS_079)
MTNCMKYHDLRDFLTLLEKQGELKRITLPVDPYLEMTEIADRTLRAGGPALLFENPKGYS
MPVLCNLFGTPRRVALGMGQEDVTALREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLN
MPTKRLRGAPCQQKVLEGDAVDLTKIPVMQCWPEDAAPLITWGLTVTRGPHKERQNLGIY
RQQLIGKNKLIMRWLSHRGGALDFQEWCAEHPGERFPVSVALGADPATILGAVTPVPDTL
SEYAFAGLLRGTKTEVVKCISNDLEVPASAEIVLEGYLEQGEMAPEGPYGDHTGYYNEVD
NFPVFTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPE
GCSYRLAVVTMKKQYPGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWNDVIWAITT
RMDPARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETEREWGRPIKKDPAVTA
RIDAIWDELAIMNNGKPETGR