Protein Info for MPMX20_04432 in Enterobacter sp. TBS_079

Annotation: Protoporphyrinogen IX dehydrogenase [menaquinone]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12724: Flavodoxin_5
  • amino acids 4 to 152 (149 residues), 172.3 bits, E=3.9e-55

Best Hits

Swiss-Prot: 78% identical to HEMG_ECOLI: Protoporphyrinogen IX dehydrogenase [menaquinone] (hemG) from Escherichia coli (strain K12)

KEGG orthology group: K00230, protoporphyrinogen oxidase [EC: 1.3.3.4] (inferred from 94% identity to enc:ECL_04947)

MetaCyc: 78% identical to protoporphyrinogen oxidase (Escherichia coli K-12 substr. MG1655)
RXN-21483 [EC: 1.3.5.3]; 1.3.5.3 [EC: 1.3.5.3]

Predicted SEED Role

"Protoporphyrinogen IX oxidase, oxygen-independent, HemG (EC 1.3.-.-)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.-.-)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• heme b biosynthesis II (oxygen-independent) (4/4 steps found)
• heme b biosynthesis V (aerobic) (4/4 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (3/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (3/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (3/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Biosynthesis of alkaloids derived from shikimate pathway
• Limonene and pinene degradation
• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.- or 1.3.3.4 or 1.3.5.3

Protein Sequence (181 amino acids)

>MPMX20_04432 Protoporphyrinogen IX dehydrogenase [menaquinone] (Enterobacter sp. TBS_079)
MKTLILFSTRDGQTREIASYLASELKELGIYSDVVNLNRTEQIAWQDYDRVVIGASIRYG
HFHPALDRFVKKHTAVLNKLPGAFYSVNLVARKPEKRTPQTNSYTRKFLLSSPWQPDISA
VFAGALRYPRYRWYDRFMIHLIMKMTGGETDTRKEVVYTDWSQVASFAREIAHLSGDSRL
K