Protein Info for MPMX20_04424 in Enterobacter sp. TBS_079

Annotation: Endoglucanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01270: Glyco_hydro_8" amino acids 1 to 330 (330 residues), 326.5 bits, see alignment E=9.5e-102

Best Hits

Swiss-Prot: 61% identical to GUN_CELUD: Endoglucanase from Cellulomonas uda

KEGG orthology group: K01179, endoglucanase [EC: 3.2.1.4] (inferred from 79% identity to ent:Ent638_3936)

Predicted SEED Role

"Endoglucanase precursor (EC 3.2.1.4)" (EC 3.2.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.4

Use Curated BLAST to search for 3.2.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>MPMX20_04424 Endoglucanase (Enterobacter sp. TBS_079)
MRKPACAALAVMMSLLFSPLSQAGQAWESYKARFFTPEGRIVDTGNGNVSHTEGQGFAML
MAVANDDKATFDKLWKWTDSTLNNKENGLFYWRYNPAESNPIADKNNAADGDVLIAWALL
KADTRWHDKQYSAASDAITKALISHTVTRYAGYRVMLPGVQGFTLDGEIVLNPSYFVFPA
WQAFASRSHSPVWGKLIQDGHRLLAKMGSGKVRLPTDWVSLGSTGTLSPAKAWPPRMSYD
AIRIPLYLAWSDKKSPLLTPWRAWFGQFPREQTPAWVNVTTNEYAPYMMEGGLLAVRDLT
MGQPSGEPEITAKDDYYSASLKMLVWLAEQP