Protein Info for MPMX20_04377 in Enterobacter sp. TBS_079

Annotation: putative 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF01522: Polysacc_deac_1" amino acids 15 to 161 (147 residues), 27.3 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 77% identical to ARND_KLEP7: Probable 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (arnD) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K13014, undecaprenyl phosphate-alpha-L-ara4FN deformylase [EC: 3.5.-.-] (inferred from 91% identity to enc:ECL_04860)

Predicted SEED Role

"Polymyxin resistance protein PmrJ, predicted deacetylase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Isozymes

Compare fitness of predicted isozymes for: 3.5.-.-

Use Curated BLAST to search for 3.5.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>MPMX20_04377 putative 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD (Enterobacter sp. TBS_079)
MRKVGLRIDVDTFRGTRDGVPKLLELLSKHNVRSSIFFSVGPDNMGRHLWRLVKPAFLFK
MLRSRAASLYGWDILLAGTAWPGRRIGAGNEAVIRDAAQHHEVGLHAWDHHAWQAWAGVW
DIPRLSREVERGMLELEAITGQTIRCSAVAGWRADQRVVKAKEPFAFRYNSDCRGTGPFL
PLIGENRLGTVQIPVTLPTWDEVVGREVSAGGFNRYILDCIHRDTGTPVYTIHAEVEGIA
YQHDFDALLTMAAQEGIQFCPLSELLPEDLSVLPVGKIVRNELAGREGWLGYQQTVSPVS