Protein Info for MPMX20_04373 in Enterobacter sp. TBS_079
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to ACPT_SALTI: 4'-phosphopantetheinyl transferase AcpT (acpT) from Salmonella typhi
KEGG orthology group: K06133, 4'-phosphopantetheinyl transferase [EC: 2.7.8.-] (inferred from 80% identity to ent:Ent638_3900)MetaCyc: 67% identical to holo-[acyl carrier protein] synthase 2 (Escherichia coli K-12 substr. MG1655)
Holo-[acyl-carrier-protein] synthase. [EC: 2.7.8.7]
Predicted SEED Role
"4'-phosphopantetheinyl transferase (EC 2.7.8.-)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.-)
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- acyl carrier protein metabolism (2/2 steps found)
- acyl carrier protein activation (1/1 steps found)
- enterobactin biosynthesis (7/11 steps found)
- petrobactin biosynthesis (1/10 steps found)
KEGG Metabolic Maps
- Aminophosphonate metabolism
- Glycerophospholipid metabolism
- High-mannose type N-glycan biosynthesis
- Nucleotide sugars metabolism
- Pantothenate and CoA biosynthesis
- Sphingolipid metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.7.8.-, 2.7.8.7
Use Curated BLAST to search for 2.7.8.- or 2.7.8.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (197 amino acids)
>MPMX20_04373 hypothetical protein (Enterobacter sp. TBS_079) MYQFILGKISTLSADPLASTLAHMAPAGARNASWLAGRTLLAKTLSPSPLPEIVYGEQGK PTFVDAQPFWFNLSHSGDNIALLLSDEGEVGCDIEVIRPRENWQALANAVFSVAEHAELE REDPETKLSAFWGIWTRKEAIVKQRGGSAWQIVSIDSTSQTHSVSQLQFGSLSLAVCTST PYTLTAGTIAHHGMSVA