Protein Info for MPMX20_04367 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 774 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details transmembrane" amino acids 260 to 279 (20 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 431 to 450 (20 residues), see Phobius details amino acids 630 to 653 (24 residues), see Phobius details amino acids 661 to 681 (21 residues), see Phobius details amino acids 687 to 706 (20 residues), see Phobius details amino acids 718 to 737 (20 residues), see Phobius details amino acids 743 to 765 (23 residues), see Phobius details PF03176: MMPL" amino acids 253 to 397 (145 residues), 34.5 bits, see alignment E=5.6e-13

Best Hits

KEGG orthology group: None (inferred from 88% identity to ent:Ent638_3894)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (774 amino acids)

>MPMX20_04367 hypothetical protein (Enterobacter sp. TBS_079)
MTNANALPHRKSLRPALLWATVCLILLGVLLSLLPGARLNSSVLAMLPKQTLGAIPPALN
DAFIQRLDRQLVWLVSPGKEPDPRVAQQWLDLLKNSHSLREVKGPMDAAGQKAWGEFFWQ
HRNGLIDSATRARLQNGGEAQAQWILSQLYSAFSGVSGKELQNDPLMLMRGSQLALAQNS
QKLRLMDGWLVTQDASGNYWYMLHGELAGSSFDMQQTHQLVTTLTALQETLKTRFPQAQL
LSRGTVFYSDYASQQAKRDISTLGIVTILGVILLILAVFRSLNPLLLCLISIATGALAGT
VVTLLLFGELHLMTLVMSMSIIGISADYTLYYLTERMVHGAEHSPWQSLAKVRNALLLAL
LTTVAAYLIMMLAPFPGIRQMAVFAAVGLSASCLTVIFWHPWLCRGLPVRPVPFMVLMLR
WLAAWRRNKKLSVGLPVVLALVSAAGLATLKVNDDIAQLQALPKDILAQEKTITALTGQG
VDQKWFVVYGASPQQTLERLEAFTPALAQAQKAGDITRWRTLPLNSLARQKSDLLLLQQA
APAITNALRNAGLSTVTPNLNAMPVSVEAWLASPASEGWRLLWLTLPDGESGVLVPVDNA
RNSAALSEVAARHAGVVWVDRKASFDSLFALYRTLLTGLLFVALAVIACGAMVRLGWRKG
LISLVPSVLSLSCGLAALAVTGHPVNLFSLLALVLVLGIGINYTLFFGNPRGTPLTSMLA
ITLAMMTTLLTLGMLVFSATQAISSFGIVLVSGIFTAFLLAPLAMPVKKERKRK