Protein Info for MPMX20_04316 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 39 to 65 (27 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details PF01914: MarC" amino acids 1 to 195 (195 residues), 217.5 bits, see alignment E=6.5e-69 TIGR00427: membrane protein, MarC family" amino acids 4 to 191 (188 residues), 106.9 bits, see alignment E=5.9e-35

Best Hits

Swiss-Prot: 94% identical to YHGN_SHIFL: UPF0056 inner membrane protein YhgN (yhgN) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to ent:Ent638_3842)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>MPMX20_04316 hypothetical protein (Enterobacter sp. TBS_079)
MSEIISAAVLLILIMDPLGNLPIFMSVLKHTEPKRRRAIMIRELLIALLVMFIFLFAGEK
ILAFLNLRAETVSISGGIILFLIAIKMIFPSAEGSSSGLPAGEEPFIVPLAIPLVAGPTI
LATLMLLSHQYPNQMSHLVIALLIAWGGTFIILLQSSLFLRLLGEKGVNALERLMGLILV
MMATQMFLDGIRAWMKG