Protein Info for MPMX20_04308 in Enterobacter sp. TBS_079

Annotation: Thiosulfate sulfurtransferase GlpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00581: Rhodanese
  • amino acids 9 to 98 (90 residues), 68.8 bits, E=2.4e-23

Best Hits

Swiss-Prot: 94% identical to GLPE_ENT38: Thiosulfate sulfurtransferase GlpE (glpE) from Enterobacter sp. (strain 638)

KEGG orthology group: K02439, thiosulfate sulfurtransferase [EC: 2.8.1.1] (inferred from 98% identity to enc:ECL_04787)

MetaCyc: 84% identical to thiosulfate sulfurtransferase GlpE (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]; 2.8.1.- [EC: 2.8.1.1]

Predicted SEED Role

"Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 2.8.1.1)

MetaCyc Pathways

• thiosulfate disproportionation IV (rhodanese) (1/1 steps found)
• sulfide oxidation IV (mitochondria) (2/5 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Protein Sequence (110 amino acids)

>MPMX20_04308 Thiosulfate sulfurtransferase GlpE (Enterobacter sp. TBS_079)
MDQFECINVEEAHQKMHQGTAVLVDIRDPQSFAMGHTPGAFHLTNDSLGAFMRDNDFDTP
VMVMCYHGNSSKGAAQYLLQQGYDAVYSVDGGFDAWHRHFPAEVEYAFER