Protein Info for MPMX20_04229 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 35 to 47 (13 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details PF01478: Peptidase_A24" amino acids 10 to 116 (107 residues), 73.9 bits, see alignment E=6.7e-25

Best Hits

KEGG orthology group: K02506, leader peptidase HopD [EC: 3.4.23.43] (inferred from 77% identity to enc:ECL_04699)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>MPMX20_04229 hypothetical protein (Enterobacter sp. TBS_079)
MLIPLPFLLVYFALSGLLVREDIRAGLLPDKYLCPLLWTGLLFQLCLHPDFLSNAVTGAM
AGYVSFAIIYWGYRLLTGREGMGYGDVKYLSALGAWHGWHILPALVLTAALVALLYQLIL
ALPAPDKQALKNPLPFGPFLAAAGLSVGWQTLFSQPL