Protein Info for MPMX20_04200 in Enterobacter sp. TBS_079

Annotation: HTH-type transcriptional regulator ZntR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR02043: Zn(II)-responsive transcriptional regulator" amino acids 1 to 131 (131 residues), 211.9 bits, see alignment E=1.5e-67 PF13411: MerR_1" amino acids 2 to 69 (68 residues), 78.1 bits, see alignment E=6.8e-26 PF00376: MerR" amino acids 3 to 40 (38 residues), 53.2 bits, see alignment E=3.2e-18 PF09278: MerR-DNA-bind" amino acids 45 to 110 (66 residues), 74.3 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 86% identical to ZNTR_ECOLI: HTH-type transcriptional regulator ZntR (zntR) from Escherichia coli (strain K12)

KEGG orthology group: K13638, MerR family transcriptional regulator, Zn(II)-responsive regulator of zntA (inferred from 96% identity to enc:ECL_04669)

Predicted SEED Role

"transcriptional regulator, MerR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>MPMX20_04200 HTH-type transcriptional regulator ZntR (Enterobacter sp. TBS_079)
MYRIGELARLANVTPDTIRYYEKQQMIDHEVRTEGGFRLYTDHDLQRLRFIRYARQLGFT
LDSIRELLSIRIDPEHHTCQESKSIVQARLDEVEARIQELQTMQRSLQRLNDACCGTAHS
SIYCSILEALEQGASGTQGC