Protein Info for MPMX20_04196 in Enterobacter sp. TBS_079

Annotation: Ribosomal RNA small subunit methyltransferase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF01029: NusB" amino acids 1 to 118 (118 residues), 88 bits, see alignment E=1.5e-28 TIGR00563: 16S rRNA (cytosine(967)-C(5))-methyltransferase" amino acids 1 to 419 (419 residues), 609.8 bits, see alignment E=1.7e-187 PF01189: Methyltr_RsmB-F" amino acids 231 to 417 (187 residues), 261.7 bits, see alignment E=8.5e-82 PF13847: Methyltransf_31" amino acids 236 to 369 (134 residues), 28.8 bits, see alignment E=2e-10 PF01728: FtsJ" amino acids 237 to 367 (131 residues), 24.8 bits, see alignment E=3.8e-09

Best Hits

Swiss-Prot: 86% identical to RSMB_ENT38: Ribosomal RNA small subunit methyltransferase B (rsmB) from Enterobacter sp. (strain 638)

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 92% identity to enc:ECL_04665)

MetaCyc: 86% identical to 16S rRNA m5C967 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11591 [EC: 2.1.1.176]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase B (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.176

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>MPMX20_04196 Ribosomal RNA small subunit methyltransferase B (Enterobacter sp. TBS_079)
MAAQAVEQVVEQGQSLSNILPALQQKVSDKDKALLQELCFGVLRTLSQLEWLVNKLMSRP
MTGKQRTVHYLIMVGFYQLLHTRIPPHAALAETVEGAVVIKRPMLKGLINGVLRQFQRQQ
EELLAEFGQSEARYLHPDWLLNRLKKAWPEQWQAIADANNQRPPMWLRVNRNHHTRDAWL
ALLEEAGMSGFTHEAYPDAVRLASPAPVHALPGFDEGWVTVQDASAQGCMAWLEPKNGEH
ILDLCAAPGGKTTHILEVAPQANVMAVDVDEQRLSRVYDNLKRLGMKAQVKQGDGRKPVE
WCGETQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIKELTQLQSDILDAIWPHLKPGGT
LVYATCSVLPEENSQQIAAFLKRTPDAVLHDTGTPERPGLQNLPAAEEGDGFFYAKLIKE