Protein Info for MPMX20_04174 in Enterobacter sp. TBS_079

Annotation: Multidrug export protein AcrE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 369 (332 residues), 285.4 bits, see alignment E=2.5e-89 PF00529: CusB_dom_1" amino acids 46 to 355 (310 residues), 60.3 bits, see alignment E=2.9e-20 PF16576: HlyD_D23" amino acids 58 to 287 (230 residues), 52.6 bits, see alignment E=7.6e-18 PF13533: Biotin_lipoyl_2" amino acids 63 to 111 (49 residues), 29.8 bits, see alignment 8e-11 PF13437: HlyD_3" amino acids 173 to 284 (112 residues), 33.6 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 74% identical to ACRE_ECOLI: Multidrug export protein AcrE (acrE) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 93% identity to enc:ECL_04649)

MetaCyc: 74% identical to multidrug efflux pump membrane fusion lipoprotein AcrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>MPMX20_04174 Multidrug export protein AcrE (Enterobacter sp. TBS_079)
MTNYFRRLPLSGFIVCAVLLAGCDGQENQPPHPQAPQVSVHIVKSAPLAVTTELPGRTDA
FRVAEVRPQVSGIILRRNFTEGSDVKAGESLYQIDPATYQAAYDNAKGELAKAQAAANIA
HLTVKRYLTLVGTQYVSKQEYDQAVATAQQADASVVAAQAGVESARINLAYTKVTSPVEG
RIGKSSVTEGALVTNGQAAALATVQQLDPMYVDVTQSSSDFMRLKQTSLQKGEATSTVEL
VMENGQPYPLKGTLQFSDVTVDESTGSITLRAIFPNPQHLLLPGMFVRARIDEGTQPDAI
LVPQQGVTRTPRGDASVLVVNDKNQVESRTVVAPQAIGDRWLVTEGLKNGDRVIVSGLQK
VRPGATVVATPDTTTTPAG