Protein Info for MPMX20_04105 in Enterobacter sp. TBS_079

Annotation: Lipopolysaccharide export system protein LptC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04409: LPS export ABC transporter periplasmic protein LptC
  • amino acids 6 to 182 (177 residues), 176.1 bits, E=2.4e-56
• PF06835: LptC
  • amino acids 13 to 183 (171 residues), 179.2 bits, E=3e-57

Best Hits

Swiss-Prot: 82% identical to LPTC_ECOLI: Lipopolysaccharide export system protein LptC (lptC) from Escherichia coli (strain K12)

KEGG orthology group: K11719, lipopolysaccharide export system protein LptC (inferred from 97% identity to enc:ECL_04581)

MetaCyc: 86% identical to LPS export ABC transporter periplasmic protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"Uncharacterized protein YrbK clustered with lipopolysaccharide transporters"

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Protein Sequence (191 amino acids)

>MPMX20_04105 Lipopolysaccharide export system protein LptC (Enterobacter sp. TBS_079)
MSKTRRWVIILLSLVALVLIGVNLADRDDTQTEVVNTSEPTYKSDHSDTVVYSPEGALNY
RLIAQHVEYFSDDGISWFTQPVMTTFDKDKVPTWSIKSDRAKLTNDRMLYLYGHVEVNAL
TADSQLRKITTDNAQINLVTQDVTSQDLVTLYGTTFNSSGLRMRGNLRSKNAELIEKVRT
SYEIQNKQTQP