Protein Info for MPMX20_04074 in Enterobacter sp. TBS_079

Annotation: Transcription termination/antitermination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF08529: NusA_N" amino acids 4 to 123 (120 residues), 132.7 bits, see alignment E=1.2e-42 TIGR01953: transcription termination factor NusA" amino acids 4 to 347 (344 residues), 432 bits, see alignment E=1.5e-133 PF13184: KH_5" amino acids 235 to 302 (68 residues), 97.7 bits, see alignment E=5.1e-32 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 370 to 419 (50 residues), 71.5 bits, see alignment 4.8e-24 amino acids 445 to 494 (50 residues), 64.6 bits, see alignment 6.7e-22 PF14520: HHH_5" amino acids 437 to 491 (55 residues), 44.1 bits, see alignment 3.6e-15

Best Hits

Swiss-Prot: 96% identical to NUSA_SALTY: Transcription termination/antitermination protein NusA (nusA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 99% identity to enc:ECL_04551)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>MPMX20_04074 Transcription termination/antitermination protein NusA (Enterobacter sp. TBS_079)
MNKEILAVVEAVSNEKSLPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFR
RWVIVEEVTQPTKEITLEAARFEDESLNVGDYVEDQIESVTFDRITTQTAKQVIVQKVRE
AERALVVDQFRDQEGEIITGVVKKVNRDNISLEIKSEGLPGNAEAVILREDMLPRENFRP
GDRIRGVLYAVRPEARGAQLFVTRSKPEMLIELFRIEVPEIGEEVIEIKAAARDPGSRAK
IAVKTNDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVAS
IVVDEDKHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMTVDDLQAKHQAEAHAA
IDTFTKYLDIDEDFATVLVEEGFSTLEELAYVPMKELLEIDGLDEATVEALRERAKNALT
TLALAQEESLGDKKPADDLLNLEGLDRAIAFKLAARGVCTLEDLAEQGVDDLADIEGLTD
EKAGELIMAARNICWFGDEA