Protein Info for MPMX20_04045 in Enterobacter sp. TBS_079

Annotation: Putative D-galactosamine-6-phosphate deaminase AgaS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02815: putative sugar isomerase, AgaS family
  • amino acids 11 to 380 (370 residues), 606.8 bits, E=6.9e-187
• PF01380: SIS
  • amino acids 47 to 185 (139 residues), 68.9 bits, E=1.9e-23
  • amino acids 222 to 351 (130 residues), 52.2 bits, E=2.8e-18

Best Hits

Swiss-Prot: 86% identical to AGAS_ECOLI: Putative D-galactosamine-6-phosphate deaminase AgaS (agaS) from Escherichia coli (strain K12)

KEGG orthology group: K02082, tagatose-6-phosphate ketose/aldose isomerase [EC: 5.-.-.-] (inferred from 91% identity to enc:ECL_04525)

MetaCyc: 86% identical to D-galactosamine-6-phosphate deaminase/isomerase (Escherichia coli O157:H7)
3.5.99.-

Predicted SEED Role

"Galactosamine-6-phosphate isomerase (EC 5.3.1.-)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 5.3.1.-)

MetaCyc Pathways

• D-galactosamine and N-acetyl-D-galactosamine degradation (4/4 steps found)
• N-acetyl-D-galactosamine degradation (4/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Galactose metabolism
• Inositol phosphate metabolism
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.-

Protein Sequence (382 amino acids)

>MPMX20_04045 Putative D-galactosamine-6-phosphate deaminase AgaS (Enterobacter sp. TBS_079)
MSETNTTATTGTWTEEEIRQQPASWIRSLNNIDNLRASIDNFLTPLLRKHELRIVLTGAG
TSAFIGDIIAPWLASHTGKNITAVPTTDLVTNPMDYLSAAHPLLLVSFARSGNSPESVAA
VELANQCVPECYHLSITCNEAGSLYQTAVNSDNAYALLMPAETHDRGFAMTSSITTMMAS
CLAVFAPETINSHTFRDVADRCQTILTSLGDFSQSVFGNDPWKRIVYLGSGGLQGAARES
ALKVLELTAGKLAAFYDSPTGFRHGPKSLVDRETLVVVFVSSHPYTRQYDLDLLAELRRD
RQAMRVVAIAAETDPVVEAGPHILLPPARTFIDMEQAFCFLMYAQVFALSQSLRVGNTPD
TPSASGTVNRVVQGVVIHPWQA