Protein Info for MPMX20_03995 in Enterobacter sp. TBS_079

Annotation: Ribosomal RNA large subunit methyltransferase G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 199 to 370 (172 residues), 191.2 bits, E=2.3e-60
• PF13847: Methyltransf_31
  • amino acids 231 to 343 (113 residues), 29 bits, E=1.7e-10
• PF13649: Methyltransf_25
  • amino acids 232 to 334 (103 residues), 32.6 bits, E=2.1e-11
• PF08242: Methyltransf_12
  • amino acids 233 to 336 (104 residues), 34.9 bits, E=4.4e-12

Best Hits

Swiss-Prot: 94% identical to RLMG_CITK8: Ribosomal RNA large subunit methyltransferase G (rlmG) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K11391, ribosomal RNA large subunit methyltransferase G [EC: 2.1.1.174] (inferred from 96% identity to enc:ECL_04486)

MetaCyc: 91% identical to 23S rRNA m2G1835 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11635 [EC: 2.1.1.174]

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.174

Protein Sequence (378 amino acids)

>MPMX20_03995 Ribosomal RNA large subunit methyltransferase G (Enterobacter sp. TBS_079)
MSHLDNGFRSLNLKRFPETDDVNPLQAWEAADEYLLQQLDDTEISGPVLILNDAFGALGC
ALAEHTPYSIGDSYLSELATRENLRHNDIDESSVKFLDSTADYPQAPGVVLIKVPKTMAL
LEQQLRALRNVVTPQTRIIAGAKARDIHTSTLELFEKVLGPTTTTLAWKKARLINCTFSA
PELADAPETLSWTLEGTDWTIHNHANVFSRTGLDIGARFFIENLPDNLEGEIVDLGCGNG
VIGLTLLAKNPDASVVFSDESPMAVASSRLNVETNMPDALDRCEFMINNALSGVEPFRFN
AVFCNPPFHQKHALTDNVAWEMFHHARRCLKINGELYIVANRHLDYFHKLKKIFGNCTTV
ATNNKFVVLKSVKLGRRR