Protein Info for MPMX20_03993 in Enterobacter sp. TBS_079

Annotation: Autoinducer-2 kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF00370: FGGY_N" amino acids 3 to 250 (248 residues), 167.7 bits, see alignment E=3.5e-53 PF02782: FGGY_C" amino acids 291 to 456 (166 residues), 62.8 bits, see alignment E=4.1e-21

Best Hits

Swiss-Prot: 95% identical to LSRK_ENT38: Autoinducer-2 kinase (lsrK) from Enterobacter sp. (strain 638)

KEGG orthology group: K11216, autoinducer 2 (AI-2) kinase [EC: 2.7.1.-] (inferred from 95% identity to ent:Ent638_3538)

MetaCyc: 77% identical to autoinducer-2 kinase (Escherichia coli K-12 substr. MG1655)
RXN0-5461 [EC: 2.7.1.189]

Predicted SEED Role

"Autoinducer 2 (AI-2) kinase LsrK (EC 2.7.1.-)" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (526 amino acids)

>MPMX20_03993 Autoinducer-2 kinase (Enterobacter sp. TBS_079)
MSYLLALDAGTGSVRAVIFDLQGNQVAVGQAEWKHLSVENVPGSMEFDLDINWRLTCQCI
HQALERARLSAADIQSVACCSMREGIVLYDRNGDAIWACANVDARASREVAELKEIHDYR
FESEVYDVSGQTLALSAMPRLLWLAHHRPDIYRKAATITMISDWLAAKLSGELAVDPSNA
GTTGMLDLFSRDWRPALLDMAGLRADILSPVKETGTVLGAITKDAAQQSGLREGTPVVMG
GGDVQLGCLGLGVVRAGQTAVLGGTFWQQVVNLPQVRTDPEMNIRVNPHVIPGMAQAESI
SFFTGLTMRWFRDAFCAEEKLIAERMGMDTYSLLEEMASRVPAGSHGVMPIFSDAMHFKQ
WYHAAPSFINLSIDPEKCNKATLFRALEENAAIVSACNLTQISRFSGVTFDGLVFAGGGS
KGALWSQILSDVTGLPVRVPQVKEATALGCAIAAGTGAGLFSDMAATGERLVKWSREFTP
NPAHRELYDGMMQKWQAVYADQLGLVDSGLTTSMWQAPGLVRAPSP