Protein Info for MPMX20_03861 in Enterobacter sp. TBS_079

Annotation: DNA topoisomerase 4 subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 752 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 5 to 738 (734 residues), 1378.8 bits, see alignment E=0 PF00521: DNA_topoisoIV" amino acids 29 to 466 (438 residues), 499 bits, see alignment E=1.2e-153 PF03989: DNA_gyraseA_C" amino acids 593 to 636 (44 residues), 22 bits, see alignment 8.6e-09 amino acids 641 to 675 (35 residues), 24.7 bits, see alignment (E = 1.2e-09)

Best Hits

Swiss-Prot: 94% identical to PARC_SALTY: DNA topoisomerase 4 subunit A (parC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 98% identity to enc:ECL_04341)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (752 amino acids)

>MPMX20_03861 DNA topoisomerase 4 subunit A (Enterobacter sp. TBS_079)
MSDMAERLALHEFTENAYLNYSMYVIMDRALPFIGDGLKPVQRRIVYAMSELGLNATAKF
KKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRY
TESRLSRYAEVLLGELGQGTVDWVPNFDGTMQEPKMLPARLPNILLNGTTGIAVGMATDI
PPHNLREVAKAAITLIEQPKTTLDDLLDIVQGPDYPTEAEIITSRAEIRKIYQNGRGSVR
MRAVWTKEDGAVVITALPHQVSGAKVLEQIASQMRNKKLPMVDDLRDESDHENPTRLVIV
PRSNRVDMEQVMNHLFATTDLEKSYRINLNMIGLDGRPAVKNLLEILSEWLTFRRDTVRR
RLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRSEDEPKPALMSRFGISETQAEAILEL
KLRHLAKLEEMKIRGEQNELEKERDQLQAILASERKMNNLLKKELQADADAFGDDRRSPL
HEREEAKAMNEHDMQPSEPVTIVLSQSGWVRSAKGHDIDAPGLSYKAGDSFKAAVKGKSN
QPVAFIDSTGRSYAIDPITLPSARGQGEPLTGKLTLPPGATVDHMLMEADDQKLLLASDA
GYGFICTFNDLVSRNRAGKALISLPDNAHVMPPLVVENDSDMLLAITAAGRMLMFPVSDL
PELSKGKGNKIISIPSAEAAKGVDGLAHLFILPPQSTLTIHVGKRKIKLRPEELQKVVGE
RGRRGSLMRGLQRIDRVEIDSPARTTAGDSEE