Protein Info for MPMX20_03777 in Enterobacter sp. TBS_079

Annotation: Fructose-bisphosphate aldolase class 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01520: fructose-bisphosphate aldolase, class II
  • amino acids 4 to 358 (355 residues), 638 bits, E=4.1e-196
• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 14 to 357 (344 residues), 388 bits, E=2.8e-120
• PF01116: F_bP_aldolase
  • amino acids 17 to 355 (339 residues), 278.6 bits, E=3.2e-87

Best Hits

Swiss-Prot: 95% identical to ALF_ECOLI: Fructose-bisphosphate aldolase class 2 (fbaA) from Escherichia coli (strain K12)

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 99% identity to kpe:KPK_0745)

MetaCyc: 95% identical to fructose-bisphosphate aldolase class II (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (17/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• gluconeogenesis I (13/13 steps found)
• glycolysis I (from glucose 6-phosphate) (13/13 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• superpathway of N-acetylneuraminate degradation (19/22 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• superpathway of hexitol degradation (bacteria) (16/18 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis IV (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• sedoheptulose bisphosphate bypass (2/2 steps found)
• 1,3-propanediol biosynthesis (engineered) (7/9 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• sucrose degradation V (sucrose α-glucosidase) (3/5 steps found)
• oxygenic photosynthesis (11/17 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Protein Sequence (359 amino acids)

>MPMX20_03777 Fructose-bisphosphate aldolase class 2 (Enterobacter sp. TBS_079)
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLEAAAKVKAPVIVQ
FSNGGAAFIAGKGVKTDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLHENIEICSKYLARMAKMDMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQEYVSKKHNLPHNSLNFVFHGGSGSSAQEIKDSVSYGVVKMNIDTDTQWATWDGI
LQYYKTNEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAAQTSMVARLEQAFKELNAVDVL