Protein Info for MPMX20_03766 in Enterobacter sp. TBS_079

Annotation: 2-octaprenyl-6-methoxyphenol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01494: FAD_binding_3" amino acids 2 to 340 (339 residues), 77.9 bits, see alignment E=2.3e-25 TIGR01984: 2-polyprenyl-6-methoxyphenol 4-hydroxylase" amino acids 3 to 388 (386 residues), 461 bits, see alignment E=2.8e-142 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 3 to 387 (385 residues), 431.9 bits, see alignment E=2e-133 PF08491: SE" amino acids 247 to 355 (109 residues), 20.8 bits, see alignment E=4.7e-08

Best Hits

Swiss-Prot: 73% identical to UBIH_ECOLI: 2-octaprenyl-6-methoxyphenol hydroxylase (ubiH) from Escherichia coli (strain K12)

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 92% identity to enc:ECL_04234)

MetaCyc: 73% identical to 2-octaprenyl-6-methoxyphenol 4-hydroxylase (Escherichia coli K-12 substr. MG1655)
1.14.13.M56 [EC: 1.14.13.M56]

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.M56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>MPMX20_03766 2-octaprenyl-6-methoxyphenol hydroxylase (Enterobacter sp. TBS_079)
MSVIIVGGGMTGATLALAISHFTQGKLPVHLVEAVAPEASDHPGFDARAIALAQGTCQQL
SRIGIWQAIADCATAINTVHVSDRGHAGFVTLDAHDYRIDALGRVVELHDVGLRLFRLLK
DAPGVTLHCPARVASFSRSDASVNVVLDNGTVLEGQLLVAANGSRSSLGTQCGVEWRQQP
YGQVAVIANVSTAGAHNGRAFERFTQHGPLAMLPMSHDRSSLVWCHPQDNAAEIQTWSDE
RFCTELQKAFGWRLGRITHAGKRSVYPLSLTTASQSISHRMALVGNAAQTLHPIAGQGFN
LGLRDVMSLAETLSQAWSEQKDCGAWSVLSHYQKRRRADKEATIGVTDGLVHLFANRWAP
LVAGRNLGLMAMELFIPARDVLAQRTLGWVAR