Protein Info for MPMX20_03724 in Enterobacter sp. TBS_079

Annotation: Homoserine/homoserine lactone efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 61 (25 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 200 (186 residues), 84.4 bits, see alignment E=3.8e-28

Best Hits

KEGG orthology group: None (inferred from 88% identity to enc:ECL_04184)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>MPMX20_03724 Homoserine/homoserine lactone efflux protein (Enterobacter sp. TBS_079)
MEMSIVAGFWVVSFLLIMTPGADWAYAISAGIHGRRVVPAVMGLMSGHLLATLIVVAGVG
VMMAQHPLALSGLTIAGALYLLWLGISLLRAPGAPESATTSAANWKQWAVKGLCISGLNP
KVFLLFLALLPQFTDPKGSWSVAMQMSALGLLHLITCTLVYLLVGYGSKAILATRPQAAR
LVSRASGGMMVVIAVVLLFEQIG