Protein Info for MPMX20_03701 in Enterobacter sp. TBS_079

Annotation: Glc operon transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00392: GntR" amino acids 12 to 75 (64 residues), 77.7 bits, see alignment E=4.3e-26 PF07729: FCD" amino acids 98 to 225 (128 residues), 76.5 bits, see alignment E=2.5e-25

Best Hits

Swiss-Prot: 44% identical to EXUR_SHIFL: Exu regulon transcriptional regulator (exuR) from Shigella flexneri

KEGG orthology group: K13637, GntR family transcriptional regulator, uxuAB operon transcriptional repressor (inferred from 99% identity to enc:ECL_04161)

Predicted SEED Role

"Hexuronate utilization operon transcriptional repressor ExuR" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>MPMX20_03701 Glc operon transcriptional activator (Enterobacter sp. TBS_079)
MDKAVILPEKKQYQEIGEDLRAQIIQGHYPVGSRLPPERNIAEKYGVSRTIVREALLMLE
LQGTVDIRQGSGVYVMRIPEEHENEEERFLNSDVGPFEILQARQLLESNIAAFAAKMATR
ADIDNLRRIIEQEQRAIAANDNSQDNNKMFHLVLAGATQNQMLLATVESIWHHMDSSPLW
QQFNGHIASRAYRLKWLGDRQTILAALRRRDVMGAWQAMFQHLENVKKSLLELSDEDAPD
FDGYLFESVPVFQGKLV