Protein Info for MPMX20_03673 in Enterobacter sp. TBS_079

Annotation: Cysteine desulfurase CsdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03392: cysteine desulfurase, catalytic subunit CsdA
  • amino acids 4 to 401 (398 residues), 737.6 bits, E=2e-226
• PF00266: Aminotran_5
  • amino acids 21 to 388 (368 residues), 472.4 bits, E=5.1e-146

Best Hits

Swiss-Prot: 84% identical to CSDA_ECOLI: Cysteine desulfurase CsdA (csdA) from Escherichia coli (strain K12)

KEGG orthology group: K01766, cysteine sulfinate desulfinase [EC: 4.4.1.-] (inferred from 94% identity to enc:ECL_04136)

MetaCyc: 84% identical to cysteine sulfinate desulfinase (Escherichia coli K-12 substr. MG1655)
2.8.7.M1 [EC: 2.8.7.M1]

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE (EC 2.8.1.7), main protein CsdA" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• molybdopterin biosynthesis (6/6 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of L-alanine biosynthesis (4/4 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 2.8.7.M1 or 4.4.1.-

Protein Sequence (401 amino acids)

>MPMX20_03673 Cysteine desulfurase CsdA (Enterobacter sp. TBS_079)
MNAFSPAQFRAQFPALADAGIYLDSAATALKPQAVIEATQQFYSLSAGNVHRSQFAEAQR
LTARYEAARDQVARLINAESGKNIVWTRGTTEAINMVAQCYARPRLKPGDEIIVSEAEHH
ANLVPWLMVAEQTGARIVKLPLGADLLPDVARLSEFITPRSRILALGQMSNVTGGCPDLA
LAIDVAHANDMVVMVDGAQGVVHFPADVQKLDIDFYAFSGHKLYGPTGIGVLYGKPTLLA
QMTPWLGGGKMITEVTFEGFKTQDVPYRLEAGTPNVAGVIGLSAALEWLAETDIAQAERW
SRGLATLAEEALQKRPGFRSFRVQDSSLLAFDFAGVHHSDMVTLLAGYGIALRAGQHCAQ
PLLAALGVSGTLRASFAPYNTQSDVDALVDAVDRALEILVD