Protein Info for MPMX20_03669 in Enterobacter sp. TBS_079

Annotation: Ribosomal RNA large subunit methyltransferase M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF18125: RlmM_FDX" amino acids 1 to 71 (71 residues), 106.4 bits, see alignment E=1.3e-34 PF21239: RLMM_N" amino acids 84 to 164 (81 residues), 128.1 bits, see alignment E=1.7e-41 PF01728: FtsJ" amino acids 186 to 279 (94 residues), 39.1 bits, see alignment E=1.2e-13

Best Hits

Swiss-Prot: 93% identical to RLMM_CITK8: Ribosomal RNA large subunit methyltransferase M (rlmM) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 98% identity to enc:ECL_04132)

MetaCyc: 91% identical to 23S rRNA 2'-O-ribose C2498 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11589 [EC: 2.1.1.186]

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.186

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>MPMX20_03669 Ribosomal RNA large subunit methyltransferase M (Enterobacter sp. TBS_079)
MNKVVLYCRPGFEKECAAEITDKAAKREVFGFARVKDNAGYVVFECYQPEDADKLARELP
FSSLIFARQMFVAGELLKDLPPEDRITPVVGMLQGVVEKGGELRVEVADTNESKELMKFC
RKFTVPLRAALRDAGVLTNYETPKRPVVHIFFIAPGCCYTGYSYTNNNSPFFMGIPRLKF
PSDAPSRSTLKLEEAFHVFIPADEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVSSVD
NGPMAQSLMDTGQVTWLREDGFRYRPTRNNISWMVCDMVEKPAKVAALMASWLVNGWCRE
TIFNLKLPMKKRYEEVSQNLAYIQAQMDEHGINVEIQARQLYHDREEVTVHIRRWWAAVG
GRRDER