Protein Info for MPMX20_03646 in Enterobacter sp. TBS_079

Annotation: Putative N-acetylmannosamine-6-phosphate 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04131: NanE
  • amino acids 30 to 228 (199 residues), 235.7 bits, E=2.6e-74

Best Hits

Swiss-Prot: 81% identical to NANE_ENT38: Putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE) from Enterobacter sp. (strain 638)

KEGG orthology group: K01788, N-acylglucosamine-6-phosphate 2-epimerase [EC: 5.1.3.9] (inferred from 86% identity to enc:ECL_04109)

Predicted SEED Role

"N-acetylmannosamine-6-phosphate 2-epimerase (EC 5.1.3.9)" in subsystem Sialic Acid Metabolism (EC 5.1.3.9)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (19/22 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (3/6 steps found)
• N-acetylneuraminate and N-acetylmannosamine degradation I (1/4 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.9

Protein Sequence (235 amino acids)

>MPMX20_03646 Putative N-acetylmannosamine-6-phosphate 2-epimerase (Enterobacter sp. TBS_079)
MKTVLDNLKGKLVVSCQALENEPLHSAFIMSRMALAAAQGGAAAIRANSVVDIEAIRQQV
ALPVIGIIKRDYPDSEVFITATMKEVDELMTVSPDIIALDATARQRPGGEDLATLVAHIR
TRYPSVRLMADISSTEEAVTAQALGFDCVGTTLYGYTAETAGHALPDNDCAFLKEVLAAV
DIPVVAEGNVDTPERAARCLELGAFMVVVGGAITRPQQITARFMAAIGAQSTDGA