Protein Info for MPMX20_03631 in Enterobacter sp. TBS_079

Annotation: tRNA pseudouridine synthase D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00094: tRNA pseudouridine synthase, TruD family
  • amino acids 4 to 342 (339 residues), 307.6 bits, E=9.5e-96
• PF01142: TruD
  • amino acids 12 to 167 (156 residues), 138.7 bits, E=1.3e-44
  • amino acids 188 to 337 (150 residues), 67.2 bits, E=6.6e-23

Best Hits

Swiss-Prot: 90% identical to TRUD_ENT38: tRNA pseudouridine synthase D (truD) from Enterobacter sp. (strain 638)

KEGG orthology group: K06176, tRNA pseudouridine synthase D [EC: 5.4.99.12] (inferred from 95% identity to enc:ECL_04093)

MetaCyc: 85% identical to tRNA pseudouridine13 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11841 [EC: 5.4.99.27]

Predicted SEED Role

"tRNA pseudouridine 13 synthase (EC 4.2.1.-)" in subsystem tRNA processing (EC 4.2.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.4.99.12

Use Curated BLAST to search for 4.2.1.- or 5.4.99.12 or 5.4.99.27

Protein Sequence (349 amino acids)

>MPMX20_03631 tRNA pseudouridine synthase D (Enterobacter sp. TBS_079)
MTDFDNLTWLHGKPQGNGLLKASPEDFVVVEDLGFAPDGEGEHILVRILKNGCNTRFVAD
ALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGNTMPDLSKFELEGCKVLEYARHKRK
LRLGALKGNHFTLVLREISDRDDVEKRLNAINACGVPNYFGAQRFGIGGSNLLGALRWAQ
SDAPVRDRNKRSFWLSAARSALFNQIVSERLKKPDANQVVVGDALQLAGRGSWFVATAEE
MADVQSRVDTQTLMITAALPGTGDWGTQGDALAAEQSAVADMQALQTLLVREKVEAARRA
MLLYPQQLSWNWWDDVTVELRFWLPAGSFATSVVRELINTSGDYANIAE