Protein Info for MPMX20_03583 in Enterobacter sp. TBS_079

Annotation: Manganese transport system membrane protein MntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 16 to 16 (1 residues), see Phobius details transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details PF00950: ABC-3" amino acids 13 to 272 (260 residues), 174.3 bits, see alignment E=1.9e-55

Best Hits

Swiss-Prot: 32% identical to MNTC_BACHD: Manganese transport system membrane protein MntC (mntC) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K02075, zinc/manganese transport system permease protein (inferred from 95% identity to enc:ECL_04036)

Predicted SEED Role

"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MPMX20_03583 Manganese transport system membrane protein MntB (Enterobacter sp. TBS_079)
MIWHIFFQPFIEYGFMRRALVVCLALSVSTTALGVFLQLRRMSLMGDALSHAILPGVAVG
YLLSGMSLLAMSVGGFIAGITVALVAGLVSRRTPLKEDASFAGFYLGSLALGVTLVSLRG
SNVDLLHLLFGSILAVDNDAALFVAGVCMFTLITLAIFYRGLVTEAFDTAWLQVNARHVP
GLLHGLFLALLVLNLVAGFQVLGTLMAVGLMMLPAVAARCWARTLPGLLLMAGISGIFCA
WLGLSLSWAASLPAGPSIVLTASALFFISILFGTRSRLAGSLRALF