Protein Info for MPMX20_03562 in Enterobacter sp. TBS_079

Annotation: Transcriptional repressor MprA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF01047: MarR" amino acids 53 to 112 (60 residues), 58.9 bits, see alignment E=5.5e-20 PF12802: MarR_2" amino acids 58 to 111 (54 residues), 37.4 bits, see alignment E=3.5e-13

Best Hits

Swiss-Prot: 94% identical to MPRA_ECO57: Transcriptional repressor MprA (mprA) from Escherichia coli O157:H7

KEGG orthology group: K03712, MarR family transcriptional regulator (inferred from 97% identity to enc:ECL_04021)

Predicted SEED Role

"Transcription repressor of tripartite multidrug resistance system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>MPMX20_03562 Transcriptional repressor MprA (Enterobacter sp. TBS_079)
MDSSFTPIEQMLKFRASRHEDFPYQEILLTRLCMHMQGKLLENRNKMLKAQGINETLFMA
LITLESQENHSIQPSELSCALGSSRTNATRIADELEKRGWIERRESDNDRRCLHLQLTDK
GHQFLREVLPPQHNCLHQLWSALSTTERDQLEHITRKLLTRLDQMDEDGAVLEALR