Protein Info for MPMX20_03533 in Enterobacter sp. TBS_079

Annotation: Trans-aconitate 2-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF08003: Methyltransf_9" amino acids 30 to 141 (112 residues), 25.4 bits, see alignment E=3.3e-09 PF05175: MTS" amino acids 36 to 141 (106 residues), 26.7 bits, see alignment E=2e-09 PF13489: Methyltransf_23" amino acids 38 to 143 (106 residues), 66.3 bits, see alignment E=1.4e-21 PF01209: Ubie_methyltran" amino acids 39 to 140 (102 residues), 35.4 bits, see alignment E=3.8e-12 PF01728: FtsJ" amino acids 42 to 115 (74 residues), 23.3 bits, see alignment E=2.8e-08 PF06325: PrmA" amino acids 42 to 142 (101 residues), 34.7 bits, see alignment E=6.9e-12 PF13847: Methyltransf_31" amino acids 42 to 143 (102 residues), 61.3 bits, see alignment E=4.6e-20 PF13649: Methyltransf_25" amino acids 46 to 137 (92 residues), 82.2 bits, see alignment E=1.8e-26 PF08242: Methyltransf_12" amino acids 47 to 139 (93 residues), 60.7 bits, see alignment E=9.3e-20 PF08241: Methyltransf_11" amino acids 48 to 141 (94 residues), 89.6 bits, see alignment E=8.3e-29

Best Hits

KEGG orthology group: None (inferred from 86% identity to ent:Ent638_3139)

Predicted SEED Role

"Methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>MPMX20_03533 Trans-aconitate 2-methyltransferase (Enterobacter sp. TBS_079)
MAQNIYDNPAFFEGYARLPRSVQGLDGAPEWPALKSMLPPLSGKSVIDLGCGYGWFCRAA
RALGAAEVTGVDLSEKMLARAAELTDDVQIQYQRSDLASLALPENSVDLIYSSLALHYLP
ALETLFEKIRRALKPGGSLVFSMEHPIYTCATRQGWLTDDNGERFWGVNRYQDEGERVSN
WLADGVIKYHRTLGTTLNALIKAGLTITEVNEWGPTQAQIDAWPALAEEAERPMLVLISA
AKTQ