Protein Info for MPMX20_03524 in Enterobacter sp. TBS_079

Annotation: Vitamin B12 import ATP-binding protein BtuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 732 transmembrane" amino acids 168 to 192 (25 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 308 to 324 (17 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 423 to 445 (23 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 19 to 712 (694 residues), 777 bits, see alignment E=8.4e-238 PF00664: ABC_membrane" amino acids 172 to 437 (266 residues), 95.1 bits, see alignment E=9.4e-31 PF00005: ABC_tran" amino acids 506 to 650 (145 residues), 90.9 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 96% identity to enc:ECL_03982)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (732 amino acids)

>MPMX20_03524 Vitamin B12 import ATP-binding protein BtuD (Enterobacter sp. TBS_079)
MKQRDIPQGETMTDEALAQWAQAFGFVATRYRVACSPGALLAGAPWLKGKPMVPALTQLA
REAGLSFQLLTADQQAINSWRLPIVAAMNDGRIGVIEHFDGDDTLEVSFFDDQTYTNRLS
MAAMLPAIRHVIALRPLAALKDSRVDAYISKYRPDWLYRLVMRDLRPYSWVMLAALFINV
LSLSGIVFSMQVYDRVIPAQSYPTLYVLTIGVLIATLFGFVLRVARGHIMDLLGKRSDLR
VSDRVFGHALRLRNSAIPRSTGSFISQLRELEQIREMVTSSTISTIVDLPFFFLFVVVLA
IIAPQLAWIAPVAAVIMVLPGLLLQKKLAELAKQSAHESTLRNAVLVESVQGLEDIKLMQ
AENRFLQQWNSYIQITAESGLRTRELTQNLISWGMTIQSLVYAGVIVVGAPMVIDGTLTT
GSVVAASMLASRMIAPMATLCGVLARWQQVKAAKEGLDSIMQLPTENQREETPIRQDVLR
GHYLFEQAQFRYHPEDPRMALRINRLEIKPGEKVAILGRNGAGKSTLLQAMAGGMDLAGG
ELRLDNFSLPHLDVADVRRNVGFMTQNARLFYGTLRENITLGMPRATDEEIFEVLELTGA
AGFVQKLPKGLDYPIMENGVGLSGGQRQSILLARMLLRDPNIVLMDEPTASLDEHTEREF
IQRLSAWLGNRTLIVATHRVPVLELVERVVVLKEGMLVMDAPKAQALNNSRMQQQQQQTA
TGREWKNENQSA