Protein Info for MPMX20_03482 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details PF01595: CNNM" amino acids 2 to 169 (168 residues), 178.8 bits, see alignment E=1.3e-56 PF00571: CBS" amino acids 259 to 311 (53 residues), 29.6 bits, see alignment 1.1e-10 PF03471: CorC_HlyC" amino acids 329 to 403 (75 residues), 73.3 bits, see alignment E=2e-24

Best Hits

Swiss-Prot: 90% identical to YFJD_ECOLI: UPF0053 inner membrane protein YfjD (yfjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_03945)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>MPMX20_03482 hypothetical protein (Enterobacter sp. TBS_079)
MVVISAYFSGSETGMMTLNRYRLRHRAKQGNRAARRVEKLLRQPDRLISLVLIGNNLVNI
LASALGTIVGMRLYGNAGVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPL
LILMMPLVWLLNMVTRVLMRMIGIKADVTISSALSKEELRTIVHESRSQISRRNQDMLLS
VLDLEKVSVNDIMVPRNEIVGIDINDDWKAIVRQLTHSPHGRIVLYRDSLDDAISMLRVR
EAYRLMTEKKEFTKEVMLRAADEIYYVPEGTPLSTQLVKFQRNKKKVGLVVNEYGDIQGL
VTVEDILEEIVGDFTTSMSPSLAEEVTPQNDGSVLIDGSANIRELNKAFNWHLPEDEART
INGMILEALEEIPAAGTRVRIEQYDIDILDVQDNMIKQVKVLPVKPIRESIAE