Protein Info for MPMX20_03467 in Enterobacter sp. TBS_079

Annotation: 6-deoxy-6-sulfogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 266 to 280 (15 residues), see Phobius details PF08450: SGL" amino acids 14 to 254 (241 residues), 266.8 bits, see alignment E=1e-83

Best Hits

Swiss-Prot: 53% identical to SGL_PSEPU: 6-deoxy-6-sulfogluconolactonase (PpSQ1_00410) from Pseudomonas putida

KEGG orthology group: None (inferred from 94% identity to enc:ECL_03930)

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>MPMX20_03467 6-deoxy-6-sulfogluconolactonase (Enterobacter sp. TBS_079)
MAEPQPLLNYTGHLPECPTWSAEEHALYWADILEGEIHRYHLPTAEHTVLSFHEEVGCFA
LRERGGFIVAMRNGIWLADKHGLLQRKVCDNPSNPQLARFNDGGTDHHGRFYAGTFWGPG
DYNGAMLMRIDNDLTPKVIQCDIHGHNGLAFSPDKQWMFTSDTPNGVIYRTPLDEQGEPG
KREIFRRFKEGEGIPDGAAMDEEGCYWSAMFDGWRIARFSPQGEQLEEHRMPVRCPTMVC
FGGEDMKTLFITTTRENMDADEVAQYPLSGAIFTLPVSVAGMKKSRFIER